DOI: https://doi.org/10.34070/rif.v7i1


LA BIOINFORMÁTICA PARA EL PERFECCIONAMIENTO CURRICULAR DE LA CARRERA LICENCIATURA EN BIOLOGÍA


The bioinformática for the curricular perfection of the career degree in biology

Ania Margarita Cutiño Jiménez, Msc.

Universidad de Oriente, Cuba

https://orcid.org/0000-0002-6682-0752

aniacutino@uo.edu.cu

Gabriel Llauradó Maury, Dr. C.

Universidad de Oriente, Cuba

https://orcid.org/0000-0001-5961-9375

gabriel@uo.edu.cu

Elena Torres Barandela, Dra. C.

Universidad de Oriente, Cuba

https://orcid.org/0000-0002-3605-7020

elenatb@uo.edu.cu

Palabras claves: Bioinformática, Interdisciplinariedad, Currículo, Enseñanza-Aprendizaje.

Recibido: 27 de mayo de 2019



Keywords: Bioinformatics for the curricular improvement of the bachelor in biology major.

Aceptado: 20 de junio de 2019



RESUMEN


La Bioinformática es una ciencia ha tenido un desarrollo acelerado debido a la gran disponibilidad de información biológica. Sus aplicaciones en la Biotecnología, Farmacología, Biología y Medicina hacen de esta, un área atractiva de investigación. Sin embargo, la carencia de personal calificado y la limitada incorporación de este contenido son evidentes. Se expone experiencia en la carrera Licenciatura en Biología en la asignatura optativa Introducción a la Bioinformática en el cuarto año. El tema escogido para las clases prácticas fue el análisis de la Hemoglobina. Los resultados muestran mejora en la calidad del proceso de enseñanza aprendizaje de esta asignatura, a partir de la integración de saberes de diferentes disciplinas promueve un aprendizaje autónomo y la calidad del estudio de los estudiantes.


ABSTRACT


Bioinformatics has been a rapidly evolving interdisciplinary science in the last years due to the great availability of biological information. The numerous applications of this science in Biotechnology, Pharmacology, Biology and Medicine make it an attractive research area, and currently there is a growing demand of trained personnel in this field. However, the scarcity of qualified personnel and the limited incorporation of this content as educational resource in our university are evident. The present work is referred to an educational experience in the Bachelor in Biology major with the incorporation of the optional subject Introduction to the Bioinformatics in the fourth year. This subject has a strong practical component for the formation of skills in the students and it is taught by a team make up of teachers. The general topic chosen for the practical activities was the analysis of the Hemoglobin, topic that influences positively in the motivation of students. The results show that this experience improves the quality of the teaching and learning process, based on the integration of different knowledge areas promotes an autonomous learning and dedication of the students.



INTRODUCCIÓN

El resultado del desarrollo del sistema de educación superior, demanda cambios cualitativos en el diseño de los planes de estudio vigentes, que impliquen el perfeccionamiento del modelo de formación de perfil amplio enfocándolo al logro de una mayor pertinencia de las carreras y universidades, a las necesidades y demandas socioeconómicas actuales del país, demandas que impone el avance impetuoso de la ciencia y la tecnología en el ámbito nacional e internacional, sobre la base de fortalecer la educación durante toda la vida y la formación integral de los estudiantes, mediante un proceso docente educativo que priorice el aprendizaje y la formación de habilidades para la gestión del conocimiento.

Siendo así, el logro del perfeccionamiento continuo de los planes de estudio, es uno de los aspectos a tener en cuenta para alcanzar adecuados niveles de calidad en el proceso de formación, se adaptan las bases conceptuales del diseño de dichos planes a las demandas que impone el avance impetuoso de la ciencia y la tecnología en el ámbito nacional e internacional (MES, 2016).

En el caso particular del nivel superior, la tendencia debe estar dirigida hacia la formación de profesionales impulsen el desarrollo científico técnico, social y económico de la sociedad. Aquí la formación es entendida como proceso de sistematización de la apropiación cultural y desarrollo de las capacidades transformadoras, las cuales han de tener una intencionalidad determinada para garantizar la formación de un egresado capaz de enfrentar los desafíos actuales de las ciencias y las tecnologías de ahí que la formación se ha de condicionar en unidad con el contexto (Torres, E., 2015).

En el proceso de enseñanza aprendizaje debe prevalecer la didáctica que utilice métodos, medios y formas organizativas, que favorezcan el papel activo de los estudiantes en su proceso de formación.

Esta formación debe tener en cuenta, además, la necesidad de que las asignaturas del currículum promuevan la formación de habilidades con respecto a la utilización de las nuevas tecnologías, que les permita a los egresados hacer valoraciones bien fundamentadas de las soluciones que se dan a los problemas de su contexto, además de desarrollar actitudes y aptitudes, para motivar y sostener sus acciones desde el punto de vista investigativo.

Por consiguiente, la inserción de abordajes sistémicos, interdisciplinarios e integrativos al currículum de la carrera Licenciatura en Biología, para que las interacciones complejas entre asignaturas como Bioquímica, Genética, Fisiología Animal, Biología Evolutiva, Química Física, Biología Celular y Ciencias de la Información, sean estudiadas, favoreciendo intervenciones más efectivas que permitan lograr un egresado con posibilidades de un desempeño más eficiente, acorde al desarrollo científico técnico actual y futuro, es una necesidad cada vez más creciente.

Es propósito en este trabajo exponer las experiencias logradas con la incorporación de la asignatura optativa: Introducción a la Bioinformática en el currículo de esta carrera y el logro de habilidades prácticas en los estudiantes a partir de clases relacionadas con el estudio de la Hemoglobina (Hb) humana, utilizando herramientas de Bioinformática.

DESARROLLO

La biología moderna se ha transformado en una ciencia interdisciplinar, que integra y aplica conceptos de varias ciencias, con la consecuente introducción de nuevos conceptos y metodologías para la resolución de problemas científicos. Tal es el caso de la Bioinformática, una disciplina científica que surge como respuesta a la gran cantidad de información que se generó con el avance de tecnologías moleculares para la secuenciación de genes y proteínas, la aparición de los primeros bancos de datos biológicos y posteriormente, la secuenciación de genomas y proteomas de numerosas especies. Esta ciencia transdisciplinaria abarca campos que van desde la biología, la química, la matemática, la física y las ciencias de la computación (Schneider et al., 2010 y 2012).

Es importante destacar, que el desarrollo acelerado de la Bioinformática y sus numerosas aplicaciones en ramas como la biotecnología, la farmacología, así como las ciencias biológicas y biomédicas, hacen de esta una relevante área de investigación. En las ciencias biomédicas, por ejemplo, es aplicable en la predicción de respuestas a patógenos, susceptibilidad a microorganismos o fenómenos alérgicos, así como en el desarrollo de nuevos fármacos, adyuvantes y candidatos vacunales (Gonzalez-Argote, 2017).

Por consiguiente, la Bioinformática ha sido incluida por el Ministerio de Ciencia, Tecnología y Medio Ambiente entre las prioridades para el desarrollo científico de Cuba, siendo así, existe una creciente demanda de egresados entrenados en esta ciencia, por la carencia de personal calificado debido, fundamentalmente, al carácter interdisciplinar de la misma, que hace más compleja la incorporación de profesionales a esta área (Casanella y Rodríguez, 2015).

De manera que, para garantizar la formación de un egresado capaz de enfrentar los desafíos actuales de las ciencias y las tecnologías, se requiere del perfeccionamiento del proceso de enseñanza - aprendizaje de la carrera Licenciatura en Biología, con herramientas didácticas que permitan estimular y orientar el desarrollo hacia esta área del conocimiento.

A pesar del creciente desarrollo de programas y bases de datos para las investigaciones científicas, pocos esfuerzos han sido realizados para incorporar estas herramientas como recursos educativos en las universidades. Aunque, el proceso de enseñanza y entrenamiento en herramientas de Bioinformática constituye un reto, no sólo por el carácter interdisciplinar, sino además por su gran avance tecnológico en las últimas dos décadas (Tastan-Bishop et al., 2015).

En la medida que cambia el tipo y cantidad de datos, nuevos bancos y programas se han desarrollado para almacenarlos y procesarlos, mientras que otros recursos han quedado obsoletos o devienen redundantes. Por consecuencia la introducción en temas de Bioinformática requiere ahora el conocimiento de secuencias de genes y proteínas, estructuras de proteínas, transcriptomas y proteomas, datos de sistemas biológicos y químicos, repositorios, ontologías (Via et al., 2013).

En la carrera Licenciatura en Biología, de la Universidad de Oriente, muchos de nuestros estudiantes carecen de las habilidades del segundo y tercer nivel de computación debido, fundamentalmente, a una tendencia a evitar las asignaturas que utilicen estas herramientas.

La presente iniciativa tiene su primera experiencia en el curso 2010-2011 con la incorporación de la asignatura optativa Introducción a la Bioinformática en el cuarto año de la carrera, la cual es impartida por un colectivo de profesores de diferentes disciplinas.

Dicho colectivo estuvo a cargo del diseño de la asignatura, con la previa realización de un trabajo metodológico que les permitió elaborar el marco referencial en que se integraron, organizaron y articularon los contenidos incluidos en el programa analítico y considerando que las asignaturas optativas responden a necesidades territoriales o las impuestas por el desarrollo científico-técnico, según lo planteado por el artículo 72 de la Res. No. 210/07 (MES, 2007b p.217)

Es así, que en esta asignatura se ofrecen elementos teóricos y se entrena al estudiante con el objetivo de desarrollar habilidades prácticas que les permitan utilizar las herramientas y bases de datos para la búsqueda, procesamiento y análisis de datos moleculares. Estas herramientas de Bioinformática son utilizadas en el desarrollo de clases prácticas, no sólo en la mencionada asignatura optativa, se incluyen además en otras como: Introducción a la Filogenia molecular (optativa de quinto año) y en Biología evolutiva (del currículo base); el estudiante puede utilizarlas en el desarrollo de prácticas laborales y trabajos de diplomas relacionados con la taxonomía y filogenia de diferentes grupos de organismos, así como, para la predicción de funciones en sustancias de interés biotecnológico.

Vale la pena aclarar que, debido a su fuerte componente práctico la asignatura Introducción a la Bioinformática cuenta con una estrategia para la resolución de problemas que sitúan al estudiante ante situaciones similares a las que se enfrentará en su futuro ejercicio profesional, con la utilización del método investigativo que promueve el aprendizaje.

Las clases prácticas se han diseñado de manera que utilizan un modelo pedagógico centrado en el estudiante para que este aprenda haciendo. Se escoge el tema: análisis de las hemoglobinas A y S de humanos y de la cadena beta del orden Primates.

La búsqueda de secuencias de la cadena beta en bases de datos, como herramientas de mayor uso para el desarrollo de las clases prácticas, influye positivamente en la motivación del estudiante y promueve el aprendizaje autónomo, crítico y creativo con la aplicación de conocimientos de diferentes disciplinas como se analizará posteriormente.

En la Clase Práctica No.1 el estudiante accede a bases de datos disponibles en Internet como: PDB o protein data bank (Gutmanas et al., 2013), Uniprot y GeneBank (Benson et al., 2014) para buscar las secuencias de la cadena beta de las Hemoglobinas A y S en humanos, así como en otros primates.

En esta actividad no sólo se busca familiarizar al estudiante con la consulta de bases de datos y habituarlos en el uso de palabras claves, sino además lograr en ellos competencias en el uso de herramientas informáticas para inferir proximidad evolutiva y predecir el rol biológico de una secuencia dada.

Otros de los recursos que se les enseña y que ellos tienen la posibilidad de practicar, es la herramienta Blast para la búsqueda de secuencias por similitud (Madden, 2013). A continuación, se muestran las secuencias de las cadenas betas de ambas hemoglobinas en humanos que fueron obtenidas a partir de las bases de datos.

>A Hemoglobin subunit beta (Homo sapiens)

MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

>S Hemoglobin subunit beta (Homo sapiens)

MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVRVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Este tipo de actividad permite la participación activa de los estudiantes en la búsqueda de información para analizarla y a partir de ésta aprender a gestionar sus propios procesos de aprendizaje.

Como lo analizan Prudencia Gutiérrez y colaboradores (2011, p.180) “Una de las competencias a adquirir en el alumnado universitario, es la competencia digital, que implica aprender a gestionar la información que recibe, así como a gestionar el conocimiento que ésta genera.”

La Clase Práctica No. 2 consta de dos ejercicios. En el primer ejercicio el estudiante debe comparar las secuencias de la cadena beta de las hemoglobinas A y S en humanos utilizando el programa ClustalX.

Este programa utiliza algoritmos computacionales para la generación de matrices de similitud que permiten el agrupamiento de las secuencias acorde al número de aminoácidos que comparten. A pesar de los complejos algorítmicos teóricos del programa, la clase ofrece varios atractivos, pues se basa en una metodología para el manejo de programas de comparación mediante alineamiento.

Al comparar las secuencias, el estudiante comprueba cómo la cadena beta de las HbA y HbS difieren en el aminoácido de la sexta posición, cambiando de ácido glutámico (E) de la cadena normal por valina (V) en la cadena mutada.

Esta clase práctica permite integrar conocimientos recibidos en la asignatura Genética molecular, ya que comprueban con sus propias manos cómo el proceso de mutación es una de las fuentes de variación genética.

La figura 1 muestra el alineamiento de las cadenas beta de ambas hemoglobinas, en la que se señala la posición en la cual difieren, en el resto de los aminoácidos existen coincidencias.







Figura 1. Alineamiento de las cadenas betas de las HbA y HbS, mostrando la diferencia en la sexta posición aminoacídica.



En el segundo ejercicio el estudiante debe comparar, utilizando el mismo programa ClustalX, las secuencias de las cadenas beta de las hemoglobinas de diferentes especies del orden Primates, en este caso se incluye la cadena de la HbA de humanos. Debido a que son numerosas especies, en la figura 2 se muestra sólo parte del alineamiento de estas secuencias. En cada posición, los puntos muestran identidad con el aminoácido presente en la secuencia de humanos, y las variaciones en determinadas posiciones se muestran por la letra correspondiente con el aminoácido específico. De esta manera el estudiante puede verificar la similitud de la secuencia del hombre con el resto de los primates, contenido que será retomado en quinto año en la asignatura Biología evolutiva.











Figura 2. Alineamiento de las cadenas betas de las Hb de especies del orden Primates.



La Clase Práctica No.3 está relacionada con el uso del programa Rasmol que consiste en la representación gráfica de moléculas como proteínas, ADN y cristales. Este programa permite al estudiante interactuar con las estructuras, visualizarlas, rotarlas o aplicar animaciones sobre ellas (Reyes y Zepeda, 2016).

Esta clase práctica se relaciona con la primera donde los estudiantes comprobaron que las cadenas beta de ambos tipos de Hb varían en la posición seis y ahora analizan si esa mutación afecta las estructuras secundarias, terciarias y cuaternarias de las mismas, al comparar la estructura 3D de ambas Hb mediante el programa Rasmol. Las figuras 3 y 4 muestran la estructura 3D de las hemoglobinas A y S respectivamente, donde se observa en B que hay dos moléculas de HbS unidas por el aminoácido valina de la sexta posición de la cadena beta.



Figura 3. Estructura 3D de la HbA.





Figura 4. Estructura 3D de la HbS mostrando la unión de dos moléculas.



De esta manera, el estudiante reflexiona en cuanto a cómo una mutación puntual puede afectar la estructura y función de la proteína; en este último caso analizan como una microlesión que involucra sólo el cambio en una posición de la cadena, es considerada, por su efecto en el fenotipo como una macromutación, ya que afecta la morfología del eritrocito y es responsable de la anemia Falciforme o Drepanocítica, que es una enfermedad hereditaria. Es cuando el estudiante establece la relación de este contenido con la asignatura Genética.

Se vincula además con las asignaturas Bioquímica, Química Física y Biología Celular, porque el estudiante debe analizar que la mutación trae consigo que disminuya la solubilidad de la proteína, de tal manera que la HbS forma polímeros produciendo glóbulos rojos en forma de hoz, pocos flexibles y que son propensos a formar tapones en los vasos sanguíneos pequeños, produciendo una interrupción de la circulación de la sangre que puede dañar órganos de cualquier parte del cuerpo, además de que se incrementa la hemólisis y desciende el valor de la Hb y el hematocrito (Zavala et al., 2014). Vinculando además con la asignatura Fisiología Animal, al comprobar la relación estructura, propiedad, función y funcionabilidad, debido a que la mutación afecta las propiedades fisicoquímicas de Hb y con ello el proceso fisiológico en general.

La Clase Práctica No.4 consistió en determinar las relaciones filogenéticas entre simios y humanos, utilizando como herramienta el programa MEGA5, para el análisis de secuencias de las cadenas beta de la Hb de primates que fueron alineadas en la clase práctica anterior.

La misma consta de dos ejercicios, en el primero los estudiantes deben determinar la distancia genética entre cada par de especies y para ello es necesario que retomen conocimientos teóricos de las asignaturas Matemática y Diseño experimental. Al finalizar pueden verificar que entre el hombre y el chimpancé existe la menor distancia genética.

En el segundo ejercicio, deben inferir la filogenia del Orden Primates utilizando el método de Agrupamiento de vecinos, que se basa en una serie de cálculos matemáticos a partir de la matriz de distancia derivada del alineamiento múltiple anterior (Lemey et al., 2009). El desarrollo de este último ejercicio permite en primer lugar, que el estudiante comience a familiarizarse con la taxonomía del Orden Primates. Por otro lado, comprueban la proximidad evolutiva entre el hombre y el chimpancé, tema que sirve de base para las asignaturas Biología Evolutiva y Antropología Biológica que recibirán en el quinto año. En la figura 5 puede observarse el árbol de distancia obtenido a partir del análisis de las secuencias de la cadena beta de la Hb de primates.

















































Figura 5. Árbol de distancia de la Hb (cadena beta) de primates obtenido por los estudiantes que muestra la proximidad evolutiva entre el hombre y el chimpancé.

La esencia del modelo didáctico que se toma en cuenta para el desarrollo de estas clases prácticas es el aprender haciendo e involucra activa e intencionalmente al estudiante en la solución de problemáticas concretas, relacionados con la realidad natural y se parte de situaciones e interrogantes donde el mismo debe ser capaz de plantearse hipótesis explicativas o interpretativas.

Al constituir una clase práctica interdisciplinar permite el aprendizaje cooperativo y fomentan este tipo de competencia. La dimensión colaborativa ayuda a producir conexiones cognitivas y sociales, los estudiantes trabajan juntos para maximizar el aprendizaje de todos, se planteen hipótesis y confrontan sus puntos de vistas. (Llano Arada et al., 2016). Por otro lado, favorece la formación de habilidades relacionadas con la práctica investigativa, al situar al estudiante en situaciones similares a las de una investigación.

De acuerdo con Pérez y Rodríguez (2008), un elemento importante en el aprendizaje mediante la Bioinformática, es la interactividad constante entre el estudiante y las tácticas didácticas que son las mismas herramientas de esta ciencia, haciendo del aprender un descubrimiento y de la tecnología interactiva una motivación que estimula el aprendizaje, evaluación y el control sobre el propio proceso de aprendizaje. El estudiante concentra sus esfuerzos en hacer crecer su curiosidad intelectual.



CONCLUSIÓN

Se pudo concluir, a partir de los resultados, que la lógica integradora revelada facilita el perfeccionamiento del proceso de formación de los estudiantes de la carrera de Licenciatura en Biología, permitiendo graduar un profesional mejor preparado en el uso de herramientas modernas para la investigación, que le permita enfrentar los desafíos actuales de las ciencias y las tecnologías.

Por todo lo anterior, y dada la profundidad y el carácter positivo de las valoraciones recibidas, se concluye además que, los aportes de esta aplicación poseen valor científico-metodológico.



BIBLIOGRAFÍA

  1. Benson, D. A., Clark, K., Karsch-Mizrachi, I., Lipman, D. J., Ostell, J., & Sayers, E. W. (2014). GenBank. Nucleic acids research, 42(D1), D32-D37.

  2. Casanella, O. A., Rodríguez, K. (2015). La introducción de la Bioinformática en el Instituto Nacional de Oncología y Radiobiología. Revista Cubana de Educación Superior, 3, 166-177.

  3. Gonzalez-Argote, J. (2017). La Bioinformática en las especialidades biomédicas: ¿por qué y para qué? Revista Cubana de Reumatología, 19, 153-155.

  4. Gutmanas, A., Alhroub, Y., Battle, G. M., Berrisford, J. M., Bochet, E., Conroy, M. J., et al. (2013). PDBe: protein data bank in Europe. Nucleic acids research, 42(D1), D285-D291.

  5. Madden, T. (2013). The BLAST sequence analysis tool.

  6. Ministerio de Educación Superior (2007). Resolución No. 210/07. Reglamento para el Trabajo Docente y Metodológico en la educación superior. Gaceta oficial de la República de Cuba, La Habana, 2009-232.

  7. Lemey, P., Salemi, M. & Vandamme, A.M. (2009). The Phylogenetic Handbook. USA: Cambridge University Press, 23-24.

  8. Llano, L., Gutiérrez, M., Stable, A., Núñez, M., Masó, R. & Rojas, B. (2016). La interdisciplinariedad: una necesidad contemporánea para favorecer el proceso de enseñanza aprendizaje. MediSur, 14(3), 320-327.

  9. Pérez-Galindo, C. A., Rodríguez-Herrera, J. A. (2008). De la táctica didáctica a la práctica investigativa: experiencia desde la Bioinformática. Revista Virtual Universidad Católica del Norte, 23.

  10. Prudencia Gutiérrez, E., Yuste Tosina, R., Cubo Delgado, S., Lucero Fustes, M. (2011). Buenas prácticas en el desarrollo de trabajo colaborativo en materias TIC aplicadas en la educación. Profesorado, 15(1), 179-194.

  11. Reyes, Á. A., Zepeda, I. E. (2016). Reorientando el uso de las TIC en Química. Eutopía, 9(25), 106-114.

  12. Schneider, M. V., Walter, P., Blatter, M.C., Watson, J., Brazas, M. D., Rother, K., et al. (2012). Bioinformatics Training Network (BTN): a community resource for bioinformatics trainers. Briefings in Bioinformatics, 13(3), 383-389.

  13. Schneider, M. V., Watson, J., Attwood, T., Rother, K., Budd, A., McDowall, et al. (2010). Bioinformatics training: a review of challenges, actions and support requirements. Briefings in Bioinformatics, 11(6), 544-551.

  14. Tastan-Bishop, Ö. Adebiyi, E. F., Alzohairy, A. M., Everett, D., Ghedira, K., Ghouila, A., et al. (2015). Bioinformatics Education-Perspectives and Challenges out of Africa. Briefings in Bioinformatics, 16(2), 355-364.

  15. Torres, E., Gorina, A. y Alonso, I. (2013). Principales insuficiencias en la formación agroecológica de los estudiantes de Ingeniería Agronómica en los Centros Universitarios Municipales de Santiago de Cuba. Revista Ciencia en su PC, 1, 81-99.

  16. Via, A., Blicher, T., Bongcam-Rudloff, E., Brazas, M. D., Brooksbank, C., Budd, A., et al. (2013). Best practices in bioinformatics training for life scientists. Briefings in bioinformatics, 14(5), 528-537.

  17. Zavala, G. L., Viera, W., Castillo, G. E., Mejía, G. E., & Bustillo, P. L. (2014). Prevalencia de Anemia Drepanocítica en población de la comunidad de San Juan, Yoro. Revista de la Facultad de Ciencias Médicas, Junio, 17-25.

43

Vol. 7 No. 2, (2019): Revista de Investigación, Formación y Desarrollo: Generando

Productividad Institucional, (Agosto 2019)